SCOPe 2.06: Domain d2o2na_: 2o2n A:

Lineage for d2o2na_ (2o2n A:)

1. Root: SCOPe 2.06

2. Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
   Pfam PF00452

6. Protein Apoptosis regulator Bcl-xL [56856] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [56857] (35 PDB entries)

8. Domain d2o2na_: 2o2n A: [243291]
   automated match to d4a1ua_
   complexed with liw

Details for d2o2na_

PDB Entry: 2o2n

PDB Description: solution structure of the anti-apoptotic protein bcl-xl in complex with an acyl-sulfonamide-based ligand

PDB Compounds: (A:) apoptosis regulator bcl-x

SCOPe Domain Sequences for d2o2na_:

Sequence; same for both SEQRES and ATOM records:

>d2o2na_ f.1.4.1 (A:) Apoptosis regulator Bcl-xL {Human (Homo sapiens) [TaxId: 9606]}
sqsnrelvvdflsyklsqkgysaggggggggmaavkqalreagdefelryrrafsdltsq
lhitpgtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaawma
tylndhlepwiqenggwdtfvelyg

Timeline for d2o2na_:

• d2o2na_ first appeared in SCOPe 2.04
  
• d2o2na_ appears in SCOPe 2.05
  
• d2o2na_ appears in SCOPe 2.07
  
• d2o2na_ appears in the current release, SCOPe 2.08