SCOP 1.67: Domain d1reda_: 1red A:

Lineage for d1reda_ (1red A:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (20 families)

5. Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (2 proteins)

6. Protein Xylanase II [49979] (15 species)
   Partial overlap with common fold and the active sites of the other endoglucanases

7. Species Trichoderma reesei, xynII [TaxId:51453] [49985] (6 PDB entries)

8. Domain d1reda_: 1red A: [24329]

Details for d1reda_

PDB Entry: 1red, 1.6 Å

PDB Description: endo-1,4-beta-xylanase ii complex with 4,5-epoxypentyl-beta-d-xyloside

SCOP Domain Sequences for d1reda_:

Sequence; same for both SEQRES and ATOM records:

>d1reda_ b.29.1.11 (A:) Xylanase II {Trichoderma reesei, xynII}
etiqpgtgynngyfysywndghggvtytngpggqfsvnwsnsgnfvggkgwqpgtknkvi
nfsgsynpngnsylsvygwsrnplieyyivenfgtynpstgatklgevtsdgsvydiyrt
qrvnqpsiigtatfyqywsvrrnhrssgsvntanhfnawaqqgltlgtmdyqivavegyf
ssgsasitvs

Timeline for d1reda_:

• d1reda_ first appeared (with stable ids) in SCOP 1.55
  
• d1reda_ appears in SCOP 1.65
  
• d1reda_ appears in SCOP 1.69
  
• d1reda_ appears in the current release, SCOPe 2.08, called d1reda1