Lineage for d2o2cc_ (2o2c C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140243Fold c.80: SIS domain [53696] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345
  4. 2140244Superfamily c.80.1: SIS domain [53697] (4 families) (S)
  5. 2140302Family c.80.1.2: Phosphoglucose isomerase, PGI [53701] (2 protein domains)
    permutation of the double-SIS domain fold
    automatically mapped to Pfam PF00342
  6. 2140303Protein Phosphoglucose isomerase, PGI [53702] (8 species)
    moonlights as neuroleukin, autocrine motility factor, and differentiation mediator
  7. 2140352Species Trypanosoma brucei [TaxId:5702] [255518] (2 PDB entries)
  8. 2140355Domain d2o2cc_: 2o2c C: [243285]
    automated match to d1q50a_
    complexed with g6q, gol

Details for d2o2cc_

PDB Entry: 2o2c (more details), 1.58 Å

PDB Description: crystal structure of phosphoglucose isomerase from t. brucei containing glucose-6-phosphate in the active site
PDB Compounds: (C:) Glucose-6-phosphate isomerase, glycosomal

SCOPe Domain Sequences for d2o2cc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o2cc_ c.80.1.2 (C:) Phosphoglucose isomerase, PGI {Trypanosoma brucei [TaxId: 5702]}
adttltscaswtqlqklyeqygdepikkhfetdsergqrysvkvslgskdenflfldysk
shindeikcallrlaeergirqfvqsvfrgervnttenrpvlhialrnrsnrpiyvdgkd
vmpavnkvldqmrsfsekvrtgewkghtgkairhvvnigiggsdlgpvmatealkpfsqr
dlslhfvsnvdgthiaevlksidieatlfivasktfttqetitnalsarralldylrsrg
idekgsvakhfvalstnnqkvkefgideenmfqfwdwvggrysmwsaiglpimisigyen
fvelltgahvidehfanappeqnvplllalvgvwyinffgavthailpydqylwrlpayl
qqldmesngkyvtrsgktvstltgpiifgeagtngqhafyqlihqgtnlipcdfigaiqs
qnkigdhhkifmsnffaqtealmigkspsevrreleaagersaekinallphktfiggrp
sntlliksltpralgaiiamyehkvlvqgaiwgidsydqwgvelgkvlaksilpqlrpgm
rvnnhdsstnglinmfnelsh

SCOPe Domain Coordinates for d2o2cc_:

Click to download the PDB-style file with coordinates for d2o2cc_.
(The format of our PDB-style files is described here.)

Timeline for d2o2cc_: