Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.80: SIS domain [53696] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345 |
Superfamily c.80.1: SIS domain [53697] (4 families) |
Family c.80.1.2: Phosphoglucose isomerase, PGI [53701] (2 proteins) permutation of the double-SIS domain fold automatically mapped to Pfam PF00342 |
Protein Phosphoglucose isomerase, PGI [53702] (9 species) moonlights as neuroleukin, autocrine motility factor, and differentiation mediator |
Species Trypanosoma brucei [TaxId:5702] [255518] (2 PDB entries) |
Domain d2o2ca_: 2o2c A: [243283] automated match to d1q50a_ complexed with g6q, gol |
PDB Entry: 2o2c (more details), 1.58 Å
SCOPe Domain Sequences for d2o2ca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o2ca_ c.80.1.2 (A:) Phosphoglucose isomerase, PGI {Trypanosoma brucei [TaxId: 5702]} gadadttltscaswtqlqklyeqygdepikkhfetdsergqrysvkvslgskdenflfld yskshindeikcallrlaeergirqfvqsvfrgervnttenrpvlhialrnrsnrpiyvd gkdvmpavnkvldqmrsfsekvrtgewkghtgkairhvvnigiggsdlgpvmatealkpf sqrdlslhfvsnvdgthiaevlksidieatlfivasktfttqetitnalsarralldylr srgidekgsvakhfvalstnnqkvkefgideenmfqfwdwvggrysmwsaiglpimisig yenfvelltgahvidehfanappeqnvplllalvgvwyinffgavthailpydqylwrlp aylqqldmesngkyvtrsgktvstltgpiifgeagtngqhafyqlihqgtnlipcdfiga iqsqnkigdhhkifmsnffaqtealmigkspsevrreleaagersaekinallphktfig grpsntlliksltpralgaiiamyehkvlvqgaiwgidsydqwgvelgkvlaksilpqlr pgmrvnnhdsstnglinmfnelsh
Timeline for d2o2ca_: