![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication parallel beta-sheet of 6 strands, order 213456 |
![]() | Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) ![]() Similar in architecture to the superfamily II but partly differs in topology |
![]() | Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins) has additional insertions and/or extensions that are not grouped together |
![]() | Protein Glucose-resistance amylase regulator CcpA, C-terminal domain [117740] (2 species) |
![]() | Species Lactococcus lactis [TaxId:1358] [255517] (1 PDB entry) |
![]() | Domain d2o20h_: 2o20 H: [243280] automated match to d2nzug_ complexed with cl, so4 |
PDB Entry: 2o20 (more details), 1.9 Å
SCOPe Domain Sequences for d2o20h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o20h_ c.93.1.1 (H:) Glucose-resistance amylase regulator CcpA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} krtttvgvilptitstyfaaitrgvddiasmykynmilansdndvekeekvletflskqv dgivymgssldekirtslknsrtpvvlvgtidgdkeipsvnidyhlaayqstkklidsgn kkiayimgslkdventermvgyqealleaniefdenlvfegnysyeqgkalaerllerga tsavvshdtvavgllsammdkgvkvpedfeiisganspitqytyptltsvnqplydlgav amrlltklmlkedveqnqlvldheifsrrstk
Timeline for d2o20h_: