Lineage for d2o1ob_ (2o1o B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2010547Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2010548Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2010904Family a.128.1.0: automated matches [196408] (1 protein)
    not a true family
  6. 2010905Protein automated matches [196409] (36 species)
    not a true protein
  7. 2010921Species Cryptosporidium parvum [TaxId:5807] [255516] (2 PDB entries)
  8. 2010923Domain d2o1ob_: 2o1o B: [243272]
    automated match to d3b7la_
    complexed with mg, ris

Details for d2o1ob_

PDB Entry: 2o1o (more details), 2.42 Å

PDB Description: Cryptosporidium parvum putative polyprenyl pyrophosphate synthase (cgd4_2550) in complex with risedronate.
PDB Compounds: (B:) Putative farnesyl pyrophosphate synthase

SCOPe Domain Sequences for d2o1ob_:

Sequence, based on SEQRES records: (download)

>d2o1ob_ a.128.1.0 (B:) automated matches {Cryptosporidium parvum [TaxId: 5807]}
ydytdfinyydkfkvivynvlkklplndeirkpvieyylncidynvkkgkhirgkilvli
sslssaysnikrdsiyllgwvveaiqaliliaddimdsgkfrrgapcwyivhgqsnaind
ifflkmlslslifelssvfgndivmkiqkiynesifftvlgqhldlsyfdlskadkiser
yfsmvemktsrytfympvffgltlseiqvssaqlnlieailyklgefyqvhndvsdylfn
dsnaddicrfkltwplqksfeiadeemklkisenygknsslvkdcynllkinehyleyqr
naldyliklvkditddslqkvfihlihqiselitnsrsn

Sequence, based on observed residues (ATOM records): (download)

>d2o1ob_ a.128.1.0 (B:) automated matches {Cryptosporidium parvum [TaxId: 5807]}
ydytdfinyydkfkvivynvlkklpvieyylncidynvkkgkhirgkilvlisslssays
nikrdsiyllgwvveaiqaliliaddimdsgkfrrgapcwyivhgqsnaindifflkmls
lslifelssvfgndivmkiqkiynesifftvlgqhldlsyfdlskadkiseryfsmvemk
tsrytfympvffgltlseiqvssaqlnlieailyklgefyqvhndvsdylfndsnaddic
rfkltwplqksfeiadeemklkisenygknsslvkdcynllkinehyleyqrnaldylik
lvkditddslqkvfihlihqiselitnsrsn

SCOPe Domain Coordinates for d2o1ob_:

Click to download the PDB-style file with coordinates for d2o1ob_.
(The format of our PDB-style files is described here.)

Timeline for d2o1ob_: