Lineage for d2o1oa_ (2o1o A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1504321Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 1504322Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 1504597Family a.128.1.0: automated matches [196408] (1 protein)
    not a true family
  6. 1504598Protein automated matches [196409] (27 species)
    not a true protein
  7. 1504614Species Cryptosporidium parvum [TaxId:5807] [255516] (1 PDB entry)
  8. 1504615Domain d2o1oa_: 2o1o A: [243271]
    automated match to d3b7la_
    complexed with mg, ris

Details for d2o1oa_

PDB Entry: 2o1o (more details), 2.42 Å

PDB Description: cryptosporidium parvum putative polyprenyl pyrophosphate synthase (cgd4_2550) in complex with risedronate.
PDB Compounds: (A:) Putative farnesyl pyrophosphate synthase

SCOPe Domain Sequences for d2o1oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o1oa_ a.128.1.0 (A:) automated matches {Cryptosporidium parvum [TaxId: 5807]}
ydytdfinyydkfkvivynvlkklplndeirkpvieyylncidynvkkgkhirgkilvli
sslssaysnikrdsiyllgwvveaiqaliliaddimdsgkfrrgapcwyivhgqsnaind
ifflkmlslslifelssvfgndivmkiqkiynesifftvlgqhldlsyfdlskadkiser
yfsmvemktsrytfympvffgltlseiqvssaqlnlieailyklgefyqvhndvsdylfn
dsnaddicrfkltwplqksfeiadeemklkisenygknsslvkdcynllkinehyleyqr
naldyliklvkditddslqkvfihlihqiselitn

SCOPe Domain Coordinates for d2o1oa_:

Click to download the PDB-style file with coordinates for d2o1oa_.
(The format of our PDB-style files is described here.)

Timeline for d2o1oa_: