SCOP 1.65: Domain d1xypa_: 1xyp A:

Lineage for d1xypa_ (1xyp A:)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (15 families)

5. Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (2 proteins)

6. Protein Xylanase II [49979] (15 species)
   Partial overlap with common fold and the active sites of the other endoglucanases

7. Species Trichoderma reesei, xynII [TaxId:51453] [49985] (6 PDB entries)

8. Domain d1xypa_: 1xyp A: [24327]

Details for d1xypa_

PDB Entry: 1xyp, 1.5 Å

PDB Description: structural comparison of two major endo-1,4-beta-xylanases from trichodrema reesei

SCOP Domain Sequences for d1xypa_:

Sequence; same for both SEQRES and ATOM records:

>d1xypa_ b.29.1.11 (A:) Xylanase II {Trichoderma reesei, xynII}
etiqpgtgynngyfysywndghggvtytngpggqfsvnwsnsgnfvggkgwqpgtknkvi
nfsgsynpngnsylsvygwsrnplieyyivenfgtynpstgatklgevtsdgsvydiyrt
qrvnqpsiigtatfyqywsvrrnhrssgsvntanhfnawaqqgltlgtmdyqivavegyf
ssgsasitvs

Timeline for d1xypa_:

• d1xypa_ first appeared (with stable ids) in SCOP 1.55
  
• d1xypa_ appears in SCOP 1.63
  
• d1xypa_ appears in SCOP 1.67
  
• d1xypa_ appears in the current release, SCOPe 2.08, called d1xypa1