Lineage for d2o1ka_ (2o1k A:)

  1. Root: SCOPe 2.04
  2. 1708126Class h: Coiled coil proteins [57942] (7 folds)
  3. 1708127Fold h.1: Parallel coiled-coil [57943] (34 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 1708975Superfamily h.1.13: Rotavirus nonstructural proteins [58030] (2 families) (S)
    not a true superfamily
  5. 1708976Family h.1.13.1: NSP4 oligomerization domain [58031] (2 proteins)
  6. 1708983Protein automated matches [254616] (4 species)
    not a true protein
  7. 1708995Species Rotavirus a [TaxId:10923] [255515] (1 PDB entry)
  8. 1708996Domain d2o1ka_: 2o1k A: [243269]
    automated match to d1g1ja_
    complexed with ca

Details for d2o1ka_

PDB Entry: 2o1k (more details), 1.67 Å

PDB Description: structure of the extended diarrhea-inducing domain of rotavirus enterotoxigenic protein nsp4
PDB Compounds: (A:) non-structural glycoprotein nsp4

SCOPe Domain Sequences for d2o1ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o1ka_ h.1.13.1 (A:) automated matches {Rotavirus a [TaxId: 10923]}
iekqmdrvvkemrrqlemidklttreieqvellkriydkltvq

SCOPe Domain Coordinates for d2o1ka_:

Click to download the PDB-style file with coordinates for d2o1ka_.
(The format of our PDB-style files is described here.)

Timeline for d2o1ka_: