Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.1: Parallel coiled-coil [57943] (41 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.13: Rotavirus nonstructural proteins [58030] (2 families) not a true superfamily |
Family h.1.13.1: NSP4 oligomerization domain [58031] (2 proteins) |
Protein automated matches [254616] (6 species) not a true protein |
Species Rotavirus a [TaxId:12578] [255514] (1 PDB entry) |
Domain d2o1jc_: 2o1j C: [243267] automated match to d1g1ja_ complexed with ca |
PDB Entry: 2o1j (more details), 2.7 Å
SCOPe Domain Sequences for d2o1jc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o1jc_ h.1.13.1 (C:) automated matches {Rotavirus a [TaxId: 12578]} ietqmdrvvkemrrqlemidklttreieqvellkriydkltvrt
Timeline for d2o1jc_: