Lineage for d2o1jb_ (2o1j B:)

  1. Root: SCOPe 2.06
  2. 2265466Class h: Coiled coil proteins [57942] (7 folds)
  3. 2265467Fold h.1: Parallel coiled-coil [57943] (38 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 2266366Superfamily h.1.13: Rotavirus nonstructural proteins [58030] (2 families) (S)
    not a true superfamily
  5. 2266367Family h.1.13.1: NSP4 oligomerization domain [58031] (2 proteins)
  6. 2266374Protein automated matches [254616] (4 species)
    not a true protein
  7. 2266389Species Rotavirus a [TaxId:12578] [255514] (1 PDB entry)
  8. 2266391Domain d2o1jb_: 2o1j B: [243266]
    automated match to d1g1ja_
    complexed with ca

Details for d2o1jb_

PDB Entry: 2o1j (more details), 2.7 Å

PDB Description: structure of the extended diarrhea-inducing domain of rotavirus enterotoxigenic protein nsp4
PDB Compounds: (B:) Nonstructural protein NSP4

SCOPe Domain Sequences for d2o1jb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o1jb_ h.1.13.1 (B:) automated matches {Rotavirus a [TaxId: 12578]}
ietqmdrvvkemrrqlemidklttreieqvellkriydkltvr

SCOPe Domain Coordinates for d2o1jb_:

Click to download the PDB-style file with coordinates for d2o1jb_.
(The format of our PDB-style files is described here.)

Timeline for d2o1jb_: