SCOPe 2.05: Domain d1enxb_: 1enx B:

Lineage for d1enxb_ (1enx B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)

6. Protein Xylanase II [49979] (19 species)
   Partial overlap with common fold and the active sites of the other endoglucanases

7. Species Trichoderma reesei, xynII [TaxId:51453] [49985] (16 PDB entries)

8. Domain d1enxb_: 1enx B: [24326]

Details for d1enxb_

PDB Entry: 1enx, 1.5 Å

PDB Description: structural comparison of two major endo-1,4-beta-xylanases from trichodrema reesei

PDB Compounds: (B:) endo-1,4-beta-xylanase II

SCOPe Domain Sequences for d1enxb_:

Sequence; same for both SEQRES and ATOM records:

>d1enxb_ b.29.1.11 (B:) Xylanase II {Trichoderma reesei, xynII [TaxId: 51453]}
etiqpgtgynngyfysywndghggvtytngpggqfsvnwsnsgnfvggkgwqpgtknkvi
nfsgsynpngnsylsvygwsrnplieyyivenfgtynpstgatklgevtsdgsvydiyrt
qrvnqpsiigtatfyqywsvrrnhrssgsvntanhfnawaqqgltlgtmdyqivavegyf
ssgsasitvs

Timeline for d1enxb_:

• d1enxb_ first appeared (with stable ids) in SCOP 1.55
  
• d1enxb_ appears in SCOPe 2.04
  
• d1enxb_ is called d1enxb1 in SCOPe 2.06
  
• d1enxb_ appears in the current release, SCOPe 2.08, called d1enxb1