Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
Protein automated matches [226839] (42 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [224896] (40 PDB entries) |
Domain d2nztb2: 2nzt B:223-465 [243255] automated match to d1czan2 complexed with bg6, glc, unx |
PDB Entry: 2nzt (more details), 2.45 Å
SCOPe Domain Sequences for d2nztb2:
Sequence, based on SEQRES records: (download)
>d2nztb2 c.55.1.0 (B:223-465) automated matches {Human (Homo sapiens) [TaxId: 9606]} nceiglivgtgsnacymeemrhidmvegdegrmcinmewgafgddgslndirtefdqeid mgslnpgkqlfekmisgmymgelvrlilvkmakeellfggklspellntgrfetkdisdi egekdgirkarevlmrlgldptqedcvathricqivstrsaslcaatlaavlqrikenkg eerlrstigvdgsvykkhphfakrlhktvrrlvpgcdvrflrsedgsgkgaamvtavayr lad
>d2nztb2 c.55.1.0 (B:223-465) automated matches {Human (Homo sapiens) [TaxId: 9606]} nceiglivgtgsnacymeemrhidmvegdegrmcinmewgafgddgslndirtefdqeid mgslnpgkqlfekmisgmymgelvrlilvkmakeellfggklspellntgrfetkdisdi egedgirkarevlmrlgldptqedcvathricqivstrsaslcaatlaavlqrikenkge lrstigvdgsvykkhphfakrlhktvrrlvpgcdvrflrsedgsgkgaamvtavayrlad
Timeline for d2nztb2:
View in 3D Domains from other chains: (mouse over for more information) d2nzta1, d2nzta2, d2nzta3, d2nzta4 |