Lineage for d2nzta2 (2nzt A:223-465)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2460924Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2460925Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2462168Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 2462169Protein automated matches [226839] (53 species)
    not a true protein
  7. 2462308Species Human (Homo sapiens) [TaxId:9606] [224896] (58 PDB entries)
  8. 2462447Domain d2nzta2: 2nzt A:223-465 [243251]
    automated match to d1czan2
    complexed with bg6, glc, unx

Details for d2nzta2

PDB Entry: 2nzt (more details), 2.45 Å

PDB Description: crystal structure of human hexokinase ii
PDB Compounds: (A:) Hexokinase-2

SCOPe Domain Sequences for d2nzta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nzta2 c.55.1.0 (A:223-465) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nceiglivgtgsnacymeemrhidmvegdegrmcinmewgafgddgslndirtefdqeid
mgslnpgkqlfekmisgmymgelvrlilvkmakeellfggklspellntgrfetkdisdi
egekdgirkarevlmrlgldptqedcvathricqivstrsaslcaatlaavlqrikenkg
eerlrstigvdgsvykkhphfakrlhktvrrlvpgcdvrflrsedgsgkgaamvtavayr
lad

SCOPe Domain Coordinates for d2nzta2:

Click to download the PDB-style file with coordinates for d2nzta2.
(The format of our PDB-style files is described here.)

Timeline for d2nzta2: