Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
Protein automated matches [226839] (64 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [224896] (72 PDB entries) |
Domain d2nzta1: 2nzt A:17-222 [243250] automated match to d1czan1 complexed with bg6, glc, unx |
PDB Entry: 2nzt (more details), 2.45 Å
SCOPe Domain Sequences for d2nzta1:
Sequence, based on SEQRES records: (download)
>d2nzta1 c.55.1.0 (A:17-222) automated matches {Human (Homo sapiens) [TaxId: 9606]} dqvqkvdqylyhmrlsdetlleiskrfrkemekglgatthptaavkmlptfvrstpdgte hgeflaldlggtnfrvlwvkvtdnglqkvemenqiyaipedimrgsgtqlfdhiaeclan fmdklqikdkklplgftfsfpchqtkldesflvswtkgfkssgvegrdvvalirkaiqrr gdfdidivavvndtvgtmmtcgyddh
>d2nzta1 c.55.1.0 (A:17-222) automated matches {Human (Homo sapiens) [TaxId: 9606]} dqvqkvdqylyhmrlsdetlleiskrfrkemekglgatthptaavkmlptfvrstpdgte hgeflaldlggtnfrvlwvkvvemenqiyaipedimrgsgtqlfdhiaeclanfmdklqi kdkklplgftfsfpchqtkldesflvswtkgfkssgvegrdvvalirkaiqrrgdfdidi vavvndtvgtmmtcgyddh
Timeline for d2nzta1:
View in 3D Domains from other chains: (mouse over for more information) d2nztb1, d2nztb2, d2nztb3, d2nztb4 |