Lineage for d1enxa_ (1enx A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1779936Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1779937Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1781369Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)
  6. 1781414Protein Xylanase II [49979] (19 species)
    Partial overlap with common fold and the active sites of the other endoglucanases
  7. 1781526Species Trichoderma reesei, xynII [TaxId:51453] [49985] (16 PDB entries)
  8. 1781531Domain d1enxa_: 1enx A: [24325]

Details for d1enxa_

PDB Entry: 1enx (more details), 1.5 Å

PDB Description: structural comparison of two major endo-1,4-beta-xylanases from trichodrema reesei
PDB Compounds: (A:) endo-1,4-beta-xylanase II

SCOPe Domain Sequences for d1enxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1enxa_ b.29.1.11 (A:) Xylanase II {Trichoderma reesei, xynII [TaxId: 51453]}
etiqpgtgynngyfysywndghggvtytngpggqfsvnwsnsgnfvggkgwqpgtknkvi
nfsgsynpngnsylsvygwsrnplieyyivenfgtynpstgatklgevtsdgsvydiyrt
qrvnqpsiigtatfyqywsvrrnhrssgsvntanhfnawaqqgltlgtmdyqivavegyf
ssgsasitvs

SCOPe Domain Coordinates for d1enxa_:

Click to download the PDB-style file with coordinates for d1enxa_.
(The format of our PDB-style files is described here.)

Timeline for d1enxa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1enxb_