SCOPe 2.06: Domain d2nwma1: 2nwm A:0-56

Lineage for d2nwma1 (2nwm A:0-56)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.0: automated matches [191375] (1 protein)
   not a true family

6. Protein automated matches [190457] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187598] (90 PDB entries)

8. Domain d2nwma1: 2nwm A:0-56 [243246]
   Other proteins in same PDB: d2nwma2
   automated match to d1w6xa_

Details for d2nwma1

PDB Entry: 2nwm

PDB Description: solution structure of the first sh3 domain of human vinexin and its interaction with the peptides from vinculin

PDB Compounds: (A:) Vinexin

SCOPe Domain Sequences for d2nwma1:

Sequence; same for both SEQRES and ATOM records:

>d2nwma1 b.34.2.0 (A:0-56) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mkaarlkfdfqaqspkeltlqkgdivyihkevdknwlegehhgrlgifpanyvevlp

Timeline for d2nwma1:

• d2nwma1 first appeared in SCOPe 2.04, called d2nwma_
  
• d2nwma1 was called d2nwma_ in SCOPe 2.05
  
• d2nwma1 appears in SCOPe 2.07
  
• d2nwma1 appears in the current release, SCOPe 2.08