Lineage for d2nwma_ (2nwm A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1783288Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1783415Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 1783856Family b.34.2.0: automated matches [191375] (1 protein)
    not a true family
  6. 1783857Protein automated matches [190457] (8 species)
    not a true protein
  7. 1783907Species Human (Homo sapiens) [TaxId:9606] [187598] (88 PDB entries)
  8. 1784027Domain d2nwma_: 2nwm A: [243246]
    automated match to d1w6xa_

Details for d2nwma_

PDB Entry: 2nwm (more details)

PDB Description: solution structure of the first sh3 domain of human vinexin and its interaction with the peptides from vinculin
PDB Compounds: (A:) Vinexin

SCOPe Domain Sequences for d2nwma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nwma_ b.34.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mkaarlkfdfqaqspkeltlqkgdivyihkevdknwlegehhgrlgifpanyvevlple

SCOPe Domain Coordinates for d2nwma_:

Click to download the PDB-style file with coordinates for d2nwma_.
(The format of our PDB-style files is described here.)

Timeline for d2nwma_: