Lineage for d2nv1d_ (2nv1 D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2079053Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2079751Family c.1.2.6: PdxS-like [141755] (2 protein domains)
    Pfam PF01680; SOR/SNZ
  6. 2079760Protein automated matches [193117] (4 species)
    not a true protein
  7. 2079761Species Bacillus subtilis [TaxId:1423] [230975] (2 PDB entries)
  8. 2079765Domain d2nv1d_: 2nv1 D: [243242]
    automated match to d2nv2i_
    complexed with cl, edo, mg

Details for d2nv1d_

PDB Entry: 2nv1 (more details), 2.08 Å

PDB Description: Structure of the synthase subunit Pdx1 (YaaD) of PLP synthase from Bacillus subtilis
PDB Compounds: (D:) Pyridoxal biosynthesis lyase pdxS

SCOPe Domain Sequences for d2nv1d_:

Sequence, based on SEQRES records: (download)

>d2nv1d_ c.1.2.6 (D:) automated matches {Bacillus subtilis [TaxId: 1423]}
rvkrgmaemqkggvimdvinaeqakiaeeagavavmalervpadiraaggvarmadptiv
eevmnavsipvmakarighivearvleamgvdyidesevltpadeefhlnkneytvpfvc
gcrdlgeatrriaegasmlrtkgepgtgniveavrhmrkvnaqvrkvvamsedelmteak
nlgapyelllqikkdgklpvvnfaaggvatpadaalmmqlgadgvfvgsgifksdnpakf
akaiveatthftdykliaelskelg

Sequence, based on observed residues (ATOM records): (download)

>d2nv1d_ c.1.2.6 (D:) automated matches {Bacillus subtilis [TaxId: 1423]}
rvkrgmaemqkggvimdvinaeqakiaeeagavavmalergvarmadptiveevmnavsi
pvmakarighivearvleamgvdyidesevltpadeefhlnkneytvpfvcgcrdlgeat
rriaegasmlrtkgepgtgniveavrhmrkvnaqvrkvvamsedelmteaknlgapyell
lqikkdgklpvvnfaaggvatpadaalmmqlgadgvfvgsgifksdnpakfakaiveatt
hftdykliaelskelg

SCOPe Domain Coordinates for d2nv1d_:

Click to download the PDB-style file with coordinates for d2nv1d_.
(The format of our PDB-style files is described here.)

Timeline for d2nv1d_: