Lineage for d1xyob_ (1xyo B:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 57551Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
  4. 57552Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (11 families) (S)
  5. 58044Family b.29.1.11: Xylanase/endoglucanase 12 [49978] (2 proteins)
  6. 58056Protein Xylanase II [49979] (11 species)
  7. 58093Species Trichoderma reesei, xynII [TaxId:51453] [49985] (6 PDB entries)
  8. 58097Domain d1xyob_: 1xyo B: [24324]

Details for d1xyob_

PDB Entry: 1xyo (more details), 1.5 Å

PDB Description: structural comparison of two major endo-1,4-beta-xylanases from trichodrema reesei

SCOP Domain Sequences for d1xyob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xyob_ b.29.1.11 (B:) Xylanase II {Trichoderma reesei, xynII}
etiqpgtgynngyfysywndghggvtytngpggqfsvnwsnsgnfvggkgwqpgtknkvi
nfsgsynpngnsylsvygwsrnplieyyivenfgtynpstgatklgevtsdgsvydiyrt
qrvnqpsiigtatfyqywsvrrnhrssgsvntanhfnawaqqgltlgtmdyqivavegyf
ssgsasitvs

SCOP Domain Coordinates for d1xyob_:

Click to download the PDB-style file with coordinates for d1xyob_.
(The format of our PDB-style files is described here.)

Timeline for d1xyob_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1xyoa_