Lineage for d2ntyd_ (2nty D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2872977Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [189883] (8 PDB entries)
  8. 2872989Domain d2ntyd_: 2nty D: [243238]
    automated match to d2j0va_
    complexed with gdp

Details for d2ntyd_

PDB Entry: 2nty (more details), 3.1 Å

PDB Description: rop4-gdp-prone8
PDB Compounds: (D:) Rac-like GTP-binding protein ARAC5

SCOPe Domain Sequences for d2ntyd_:

Sequence, based on SEQRES records: (download)

>d2ntyd_ c.37.1.0 (D:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
rfikcvtvgdgavgktcmlisytsntfptdyvptvfdnfsanvvvdgntvnlglwdtagq
edynrlrplsyrgadvfilafsliskasyenvakkwipelrhyapgvpiilvgtkldlrd
dkqffidhpgavpittnqgeelkkligspiyiecssktqqnvkavfdaaikvvlq

Sequence, based on observed residues (ATOM records): (download)

>d2ntyd_ c.37.1.0 (D:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
rfikcvtvgdgavgktcmlisytsntfptptvfdnfsanvvvdgntvnlglwdtagqedy
nrlrplsyrgadvfilafsliskasyenvakkwipelrhyapgvpiilvgtkldlrddkq
ffidhpgavpittnqgeelkkligspiyiecssktqqnvkavfdaaikvvlq

SCOPe Domain Coordinates for d2ntyd_:

Click to download the PDB-style file with coordinates for d2ntyd_.
(The format of our PDB-style files is described here.)

Timeline for d2ntyd_: