SCOPe 2.08: Domain d2ntfl1: 2ntf L:1-108

Lineage for d2ntfl1 (2ntf L:1-108)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)

8. Domain d2ntfl1: 2ntf L:1-108 [243235]
   Other proteins in same PDB: d2ntfa2, d2ntfl2
   automated match to d2op4l1
   complexed with ohm

Details for d2ntfl1

PDB Entry: 2ntf, 3.18 Å

PDB Description: Crystal Structure of a Quorum-Quenching Antibody in Complex with an N-Acyl-L-Homoserine Lactone Analog

PDB Compounds: (L:) Murine Antibody Fab RS2-1G9 Lambda Light Chain

SCOPe Domain Sequences for d2ntfl1:

Sequence; same for both SEQRES and ATOM records:

>d2ntfl1 b.1.1.1 (L:1-108) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qavvtqesalttspgetvtltcrsstgavttrnyanwvqekpdhfftgligdtnnrapgv
parfsgslighkaaltitgaqtedesvyfcalwysnhwvfgggtkltvlgq

Timeline for d2ntfl1:

• d2ntfl1 first appeared in SCOPe 2.04
  
• d2ntfl1 appears in SCOPe 2.07