SCOPe 2.08: Domain d2ntfa2: 2ntf A:109-211

Lineage for d2ntfa2 (2ntf A:109-211)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d2ntfa2: 2ntf A:109-211 [243234]
   Other proteins in same PDB: d2ntfa1, d2ntfb_, d2ntfh_, d2ntfl1
   automated match to d2op4l2
   complexed with ohm

Details for d2ntfa2

PDB Entry: 2ntf, 3.18 Å

PDB Description: Crystal Structure of a Quorum-Quenching Antibody in Complex with an N-Acyl-L-Homoserine Lactone Analog

PDB Compounds: (A:) Murine Antibody Fab RS2-1G9 Lambda Light Chain

SCOPe Domain Sequences for d2ntfa2:

Sequence; same for both SEQRES and ATOM records:

>d2ntfa2 b.1.1.2 (A:109-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
pksspsvtlfppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqs
nnkymassyltltagawerhssyscqvtheghtvekslsr

Timeline for d2ntfa2:

• d2ntfa2 first appeared in SCOPe 2.04
  
• d2ntfa2 appears in SCOPe 2.07