SCOPe 2.08: Domain d2npsb1: 2nps B:184-248

Lineage for d2npsb1 (2nps B:184-248)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.15: SNARE fusion complex [58038] (2 families)
   tetrameric parallel coiled coil

5. Family h.1.15.0: automated matches [254266] (1 protein)
   not a true family

6. Protein automated matches [254614] (3 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [255511] (1 PDB entry)

8. Domain d2npsb1: 2nps B:184-248 [243226]
   Other proteins in same PDB: d2npsb2
   automated match to d1sfcf_

Details for d2npsb1

PDB Entry: 2nps, 2.5 Å

PDB Description: crystal structure of the early endosomal snare complex

PDB Compounds: (B:) Syntaxin 13

SCOPe Domain Sequences for d2npsb1:

Sequence; same for both SEQRES and ATOM records:

>d2npsb1 h.1.15.0 (B:184-248) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
retaiqqleadildvnqifkdlammihdqgdlidsieanvessevhverasdqlqraayy
qkksr

Timeline for d2npsb1:

• d2npsb1 first appeared in SCOPe 2.04, called d2npsb_
  
• d2npsb1 appears in SCOPe 2.07