Lineage for d2npsa_ (2nps A:)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2643821Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 2644809Superfamily h.1.15: SNARE fusion complex [58038] (2 families) (S)
    tetrameric parallel coiled coil
  5. 2644927Family h.1.15.0: automated matches [254266] (1 protein)
    not a true family
  6. 2644928Protein automated matches [254614] (3 species)
    not a true protein
  7. 2644944Species Mouse (Mus musculus) [TaxId:10090] [255509] (1 PDB entry)
  8. 2644945Domain d2npsa_: 2nps A: [243225]
    Other proteins in same PDB: d2npsb2
    automated match to d1sfce_

Details for d2npsa_

PDB Entry: 2nps (more details), 2.5 Å

PDB Description: crystal structure of the early endosomal snare complex
PDB Compounds: (A:) Vesicle-associated membrane protein 4

SCOPe Domain Sequences for d2npsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2npsa_ h.1.15.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rndkikhvqnqvdevidvmqenitkviergerldelqdkseslsdnatafsnrskqlrrq
mww

SCOPe Domain Coordinates for d2npsa_:

Click to download the PDB-style file with coordinates for d2npsa_.
(The format of our PDB-style files is described here.)

Timeline for d2npsa_: