Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.1: Parallel coiled-coil [57943] (35 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.15: SNARE fusion complex [58038] (2 families) tetrameric parallel coiled coil |
Family h.1.15.0: automated matches [254266] (1 protein) not a true family |
Protein automated matches [254614] (3 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [255509] (1 PDB entry) |
Domain d2npsa_: 2nps A: [243225] automated match to d1sfce_ |
PDB Entry: 2nps (more details), 2.5 Å
SCOPe Domain Sequences for d2npsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2npsa_ h.1.15.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} rndkikhvqnqvdevidvmqenitkviergerldelqdkseslsdnatafsnrskqlrrq mww
Timeline for d2npsa_: