SCOPe 2.05: Domain d2npsa_: 2nps A:

Lineage for d2npsa_ (2nps A:)

1. Root: SCOPe 2.05

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (35 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.15: SNARE fusion complex [58038] (2 families)
   tetrameric parallel coiled coil

5. Family h.1.15.0: automated matches [254266] (1 protein)
   not a true family

6. Protein automated matches [254614] (3 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [255509] (1 PDB entry)

8. Domain d2npsa_: 2nps A: [243225]
   automated match to d1sfce_

Details for d2npsa_

PDB Entry: 2nps, 2.5 Å

PDB Description: crystal structure of the early endosomal snare complex

PDB Compounds: (A:) Vesicle-associated membrane protein 4

SCOPe Domain Sequences for d2npsa_:

Sequence; same for both SEQRES and ATOM records:

>d2npsa_ h.1.15.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rndkikhvqnqvdevidvmqenitkviergerldelqdkseslsdnatafsnrskqlrrq
mww

Timeline for d2npsa_:

• d2npsa_ first appeared in SCOPe 2.04
  
• d2npsa_ appears in SCOPe 2.06
  
• d2npsa_ appears in the current release, SCOPe 2.08