Lineage for d1xyna_ (1xyn A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1779936Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1779937Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1781369Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)
  6. 1781414Protein Xylanase II [49979] (19 species)
    Partial overlap with common fold and the active sites of the other endoglucanases
  7. 1781524Species Trichoderma reesei, xynI [TaxId:51453] [49984] (1 PDB entry)
  8. 1781525Domain d1xyna_: 1xyn A: [24322]
    complexed with ca

Details for d1xyna_

PDB Entry: 1xyn (more details), 2 Å

PDB Description: structural comparison of two major endo-1,4-beta-xylanases from trichodrema reesei
PDB Compounds: (A:) endo-1,4-beta-xylanase I

SCOPe Domain Sequences for d1xyna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xyna_ b.29.1.11 (A:) Xylanase II {Trichoderma reesei, xynI [TaxId: 51453]}
asinydqnyqtggqvsyspsntgfsvnwntqddfvvgvgwttgssapinfggsfsvnsgt
gllsvygwstnplveyyimednhnypaqgtvkgtvtsdgatytiwentrvnepsiqgtat
fnqyisvrnsprtsgtvtvqnhfnawaslglhlgqmnyqvvavegwggsgsasqsvsn

SCOPe Domain Coordinates for d1xyna_:

Click to download the PDB-style file with coordinates for d1xyna_.
(The format of our PDB-style files is described here.)

Timeline for d1xyna_: