SCOP 1.67: Domain d1xyn__: 1xyn -

Lineage for d1xyn__ (1xyn -)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (20 families)

5. Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (2 proteins)

6. Protein Xylanase II [49979] (15 species)
   Partial overlap with common fold and the active sites of the other endoglucanases

7. Species Trichoderma reesei, xynI [TaxId:51453] [49984] (1 PDB entry)

8. Domain d1xyn__: 1xyn - [24322]
   complexed with ca

Details for d1xyn__

PDB Entry: 1xyn, 2 Å

PDB Description: structural comparison of two major endo-1,4-beta-xylanases from trichodrema reesei

SCOP Domain Sequences for d1xyn__:

Sequence; same for both SEQRES and ATOM records:

>d1xyn__ b.29.1.11 (-) Xylanase II {Trichoderma reesei, xynI}
asinydqnyqtggqvsyspsntgfsvnwntqddfvvgvgwttgssapinfggsfsvnsgt
gllsvygwstnplveyyimednhnypaqgtvkgtvtsdgatytiwentrvnepsiqgtat
fnqyisvrnsprtsgtvtvqnhfnawaslglhlgqmnyqvvavegwggsgsasqsvsn

Timeline for d1xyn__:

• d1xyn__ first appeared (with stable ids) in SCOP 1.55
  
• d1xyn__ appears in SCOP 1.65
  
• d1xyn__ appears in SCOP 1.69
  
• d1xyn__ appears in the current release, SCOPe 2.08, called d1xyna_