Lineage for d2np2a_ (2np2 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715141Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily)
    core: 4 helices; bundle, partly opened, capped with a beta-sheet
  4. 2715142Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (3 families) (S)
    dimer of identical subunits
  5. 2715207Family a.55.1.0: automated matches [191573] (1 protein)
    not a true family
  6. 2715208Protein automated matches [191007] (11 species)
    not a true protein
  7. 2715222Species Lyme disease spirochete (Borrelia burgdorferi) [TaxId:139] [255508] (1 PDB entry)
  8. 2715223Domain d2np2a_: 2np2 A: [243215]
    automated match to d1p71a_
    protein/DNA complex

Details for d2np2a_

PDB Entry: 2np2 (more details), 3.02 Å

PDB Description: Hbb-DNA complex
PDB Compounds: (A:) Hbb

SCOPe Domain Sequences for d2np2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2np2a_ a.55.1.0 (A:) automated matches {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]}
rpkvtksdivdqialniknnnlklekkyirlvidaffeelksnlcsnnviefrsfgtfev
rkrkgrlnarnpqtgeyvkvldhhvayfrpgkdlkervwgik

SCOPe Domain Coordinates for d2np2a_:

Click to download the PDB-style file with coordinates for d2np2a_.
(The format of our PDB-style files is described here.)

Timeline for d2np2a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2np2b_