| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily) core: 4 helices; bundle, partly opened, capped with a beta-sheet |
Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (3 families) ![]() dimer of identical subunits |
| Family a.55.1.0: automated matches [191573] (1 protein) not a true family |
| Protein automated matches [191007] (11 species) not a true protein |
| Species Lyme disease spirochete (Borrelia burgdorferi) [TaxId:139] [255508] (1 PDB entry) |
| Domain d2np2a_: 2np2 A: [243215] automated match to d1p71a_ protein/DNA complex |
PDB Entry: 2np2 (more details), 3.02 Å
SCOPe Domain Sequences for d2np2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2np2a_ a.55.1.0 (A:) automated matches {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]}
rpkvtksdivdqialniknnnlklekkyirlvidaffeelksnlcsnnviefrsfgtfev
rkrkgrlnarnpqtgeyvkvldhhvayfrpgkdlkervwgik
Timeline for d2np2a_: