Class b: All beta proteins [48724] (177 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins) |
Protein Xylanase II [49979] (19 species) Partial overlap with common fold and the active sites of the other endoglucanases |
Species Trichoderma harzianum [TaxId:5544] [49983] (1 PDB entry) |
Domain d1xnda_: 1xnd A: [24321] |
PDB Entry: 1xnd (more details), 2 Å
SCOPe Domain Sequences for d1xnda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xnda_ b.29.1.11 (A:) Xylanase II {Trichoderma harzianum [TaxId: 5544]} qtigpgtgysngyyysywndghagvtytnggggsftvnwsnsgnfvagkgwqpgtknkvi nfsgsynpngnsylsiygwsrnplieyyivenfgtynpstgatklgevtsdgsvydiyrt qrvnqpsiigtatfyqywsvrrnhrssgsvntanhfnawashgltlgtmdyqivavegyf ssgsasitvs
Timeline for d1xnda_: