SCOPe 2.06: Domain d1xnda_: 1xnd A:

Lineage for d1xnda_ (1xnd A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)

6. Protein Xylanase II [49979] (19 species)
   Partial overlap with common fold and the active sites of the other endoglucanases

7. Species Trichoderma harzianum [TaxId:5544] [49983] (1 PDB entry)

8. Domain d1xnda_: 1xnd A: [24321]

Details for d1xnda_

PDB Entry: 1xnd, 2 Å

PDB Description: high-resolution structures of xylanases from b. circulans and t. harzianum identify a new folding pattern and implications for the atomic basis of the catalysis

PDB Compounds: (A:) xylanase

SCOPe Domain Sequences for d1xnda_:

Sequence; same for both SEQRES and ATOM records:

>d1xnda_ b.29.1.11 (A:) Xylanase II {Trichoderma harzianum [TaxId: 5544]}
qtigpgtgysngyyysywndghagvtytnggggsftvnwsnsgnfvagkgwqpgtknkvi
nfsgsynpngnsylsiygwsrnplieyyivenfgtynpstgatklgevtsdgsvydiyrt
qrvnqpsiigtatfyqywsvrrnhrssgsvntanhfnawashgltlgtmdyqivavegyf
ssgsasitvs

Timeline for d1xnda_:

• d1xnda_ first appeared (with stable ids) in SCOP 1.55, called d1xnd__
  
• d1xnda_ appears in SCOPe 2.05
  
• d1xnda_ appears in SCOPe 2.07
  
• d1xnda_ appears in the current release, SCOPe 2.08