Lineage for d1xnda_ (1xnd A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2373039Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2373040Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2374612Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 protein domains)
  6. 2374657Protein Xylanase II [49979] (19 species)
    Partial overlap with common fold and the active sites of the other endoglucanases
  7. 2374751Species Trichoderma harzianum [TaxId:5544] [49983] (1 PDB entry)
  8. 2374752Domain d1xnda_: 1xnd A: [24321]

Details for d1xnda_

PDB Entry: 1xnd (more details), 2 Å

PDB Description: high-resolution structures of xylanases from b. circulans and t. harzianum identify a new folding pattern and implications for the atomic basis of the catalysis
PDB Compounds: (A:) xylanase

SCOPe Domain Sequences for d1xnda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xnda_ b.29.1.11 (A:) Xylanase II {Trichoderma harzianum [TaxId: 5544]}
qtigpgtgysngyyysywndghagvtytnggggsftvnwsnsgnfvagkgwqpgtknkvi
nfsgsynpngnsylsiygwsrnplieyyivenfgtynpstgatklgevtsdgsvydiyrt
qrvnqpsiigtatfyqywsvrrnhrssgsvntanhfnawashgltlgtmdyqivavegyf
ssgsasitvs

SCOPe Domain Coordinates for d1xnda_:

Click to download the PDB-style file with coordinates for d1xnda_.
(The format of our PDB-style files is described here.)

Timeline for d1xnda_: