SCOPe 2.06: Domain d2no8a_: 2no8 A:

Lineage for d2no8a_ (2no8 A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.2: Colicin E immunity proteins [47345] (2 families)
   automatically mapped to Pfam PF01320

5. Family a.28.2.1: Colicin E immunity proteins [47346] (4 proteins)

6. Protein automated matches [190365] (1 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187200] (5 PDB entries)

8. Domain d2no8a_: 2no8 A: [243209]
   automated match to d1impa_

Details for d2no8a_

PDB Entry: 2no8

PDB Description: nmr structure analysis of the colicin immuntiy protein im2

PDB Compounds: (A:) colicin-e2 immunity protein

SCOPe Domain Sequences for d2no8a_:

Sequence; same for both SEQRES and ATOM records:

>d2no8a_ a.28.2.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
elkhsisdyteaeflefvkkicraegateeddnklvreferltehpdgsdliyyprddre
dspegivkeikewraangksgfkqg

Timeline for d2no8a_:

• d2no8a_ first appeared in SCOPe 2.04
  
• d2no8a_ appears in SCOPe 2.05
  
• d2no8a_ appears in SCOPe 2.07
  
• d2no8a_ appears in the current release, SCOPe 2.08