Class b: All beta proteins [48724] (174 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins) |
Protein Xylanase II [49979] (17 species) Partial overlap with common fold and the active sites of the other endoglucanases |
Species Bacillus agaradhaerens [TaxId:76935] [49982] (4 PDB entries) |
Domain d1qh6b_: 1qh6 B: [24320] complexed with fxp |
PDB Entry: 1qh6 (more details), 2 Å
SCOPe Domain Sequences for d1qh6b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qh6b_ b.29.1.11 (B:) Xylanase II {Bacillus agaradhaerens [TaxId: 76935]} eivtdnsignhdgydyefwkdsggsgtmilnhggtfsaqwnnvnnilfrkgkkfnetqth qqvgnmsinyganfqpngnaylcvygwtvdplveyyivdswgnwrppgatpkgtitvdgg tydiyetlrvnqpsikgiatfkqywsvrrskrtsgtisvsnhfrawenlgmnmgkmyeva ltvegyqssgsanvysntlringnpls
Timeline for d1qh6b_: