SCOPe 2.06: Domain d2nnlf_: 2nnl F:

Lineage for d2nnlf_ (2nnl F:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (239 species)
   not a true protein

7. Species Grape (Vitis vinifera) [TaxId:29760] [255079] (11 PDB entries)

8. Domain d2nnlf_: 2nnl F: [243199]
   automated match to d2p4hx_
   complexed with erd, nap

Details for d2nnlf_

PDB Entry: 2nnl, 2.1 Å

PDB Description: binding of two substrate analogue molecules to dihydroflavonol-4- reductase alters the functional geometry of the catalytic site

PDB Compounds: (F:) dihydroflavonol 4-reductase

SCOPe Domain Sequences for d2nnlf_:

Sequence; same for both SEQRES and ATOM records:

>d2nnlf_ c.2.1.0 (F:) automated matches {Grape (Vitis vinifera) [TaxId: 29760]}
setvcvtgasgfigswlvmrllergytvratvrdptnvkkvkhlldlpkaethltlwkad
ladegsfdeaikgctgvfhvatpmdfeskdpenevikptiegmlgimkscaaaktvrrlv
ftssagtvniqehqlpvydescwsdmefcrakkmtawmyfvsktlaeqaawkyakennid
fitiiptlvvgpfimssmppslitalspitgneahysiirqgqfvhlddlcnahiylfen
pkaegryicsshdciildlakmlrekypeyniptefkgvdenlksvcfsskkltdlgfef
kysledmftgavdtcrakgllppshe

Timeline for d2nnlf_:

• d2nnlf_ first appeared in SCOPe 2.04
  
• d2nnlf_ appears in SCOPe 2.05
  
• d2nnlf_ appears in SCOPe 2.07
  
• d2nnlf_ appears in the current release, SCOPe 2.08