SCOPe 2.06: Domain d2mlec_: 2mle C:

Lineage for d2mlec_ (2mle C:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein automated matches [190064] (21 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186813] (24 PDB entries)

8. Domain d2mlec_: 2mle C: [243196]
   automated match to d1ozsa_
   complexed with ca

Details for d2mlec_

PDB Entry: 2mle

PDB Description: nmr structure of the c-domain of troponin c bound to the anchoring region of troponin i

PDB Compounds: (C:) troponin c, slow skeletal and cardiac muscles

SCOPe Domain Sequences for d2mlec_:

Sequence; same for both SEQRES and ATOM records:

>d2mlec_ a.39.1.5 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mgkseeelsdlfrmfdknadgyidldelkimlqatgetiteddieelmkdgdknndgrid
ydeflefmkgve

Timeline for d2mlec_:

• d2mlec_ first appeared in SCOPe 2.04
  
• d2mlec_ appears in SCOPe 2.05
  
• d2mlec_ appears in SCOPe 2.07
  
• d2mlec_ appears in the current release, SCOPe 2.08, called d2mlec1