SCOPe 2.08: Domain d2mlec1: 2mle C:91-161

Lineage for d2mlec1 (2mle C:91-161)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Troponin C [47503] (6 species)

7. Species Human (Homo sapiens), cardiac isoform [TaxId:9606] [47508] (28 PDB entries)

8. Domain d2mlec1: 2mle C:91-161 [243196]
   Other proteins in same PDB: d2mlec2
   automated match to d1ozsa_
   complexed with ca
   fragment; missing more than one-third of the common structure and/or sequence

Details for d2mlec1

PDB Entry: 2mle

PDB Description: nmr structure of the c-domain of troponin c bound to the anchoring region of troponin i

PDB Compounds: (C:) troponin c, slow skeletal and cardiac muscles

SCOPe Domain Sequences for d2mlec1:

Sequence; same for both SEQRES and ATOM records:

>d2mlec1 a.39.1.5 (C:91-161) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]}
gkseeelsdlfrmfdknadgyidldelkimlqatgetiteddieelmkdgdknndgridy
deflefmkgve

Timeline for d2mlec1:

• d2mlec1 first appeared in SCOPe 2.04, called d2mlec_
  
• d2mlec1 was called d2mlec_ in SCOPe 2.07