Lineage for d2mkra_ (2mkr A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2070980Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2070981Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2071513Family b.55.1.9: TFIIH domain [110272] (2 proteins)
  6. 2071514Protein RNA polymerase II transcription factor B 73 kDa, TFB1 [141434] (2 species)
  7. 2071515Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [141435] (10 PDB entries)
    Uniprot P32776 2-115
  8. 2071522Domain d2mkra_: 2mkr A: [243194]
    automated match to d1y5oa1

Details for d2mkra_

PDB Entry: 2mkr (more details)

PDB Description: Structural Characterization of a Complex Between the Acidic Transactivation Domain of EBNA2 and the Tfb1/p62 subunit of TFIIH.
PDB Compounds: (A:) RNA polymerase II transcription factor B subunit 1

SCOPe Domain Sequences for d2mkra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mkra_ b.55.1.9 (A:) RNA polymerase II transcription factor B 73 kDa, TFB1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pshsgaaifekvsgiiainedvspaeltwrstdgdkvhtvvlstidklqatpassekmml
rligkvdeskkrkdnegnevvpkpqrhmfsfnnrtvmdnikmtlqqiisrykdad

SCOPe Domain Coordinates for d2mkra_:

Click to download the PDB-style file with coordinates for d2mkra_.
(The format of our PDB-style files is described here.)

Timeline for d2mkra_: