Lineage for d2mk3a_ (2mk3 A:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3042053Superfamily h.3.2: Virus ectodomain [58069] (2 families) (S)
  5. 3042189Family h.3.2.0: automated matches [254265] (1 protein)
    not a true family
  6. 3042190Protein automated matches [254613] (3 species)
    not a true protein
  7. 3042201Species Human immunodeficiency virus 1 [TaxId:11676] [255504] (1 PDB entry)
  8. 3042202Domain d2mk3a_: 2mk3 A: [243193]
    automated match to d1jq0a_

Details for d2mk3a_

PDB Entry: 2mk3 (more details)

PDB Description: Solution NMR structure of gp41 ectodomain monomer on a DPC micelle
PDB Compounds: (A:) Transmembrane glycoprotein, chimeric construct

SCOPe Domain Sequences for d2mk3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mk3a_ h.3.2.0 (A:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
sgivqqqnnllraieaqqhllqltvwgikqlqarsggrggwmewdreinnytslihslie
esqnqqek

SCOPe Domain Coordinates for d2mk3a_:

Click to download the PDB-style file with coordinates for d2mk3a_.
(The format of our PDB-style files is described here.)

Timeline for d2mk3a_: