Lineage for d2mk2a1 (2mk2 A:12-109)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2571840Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2571841Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2572318Family d.93.1.0: automated matches [191409] (1 protein)
    not a true family
  6. 2572319Protein automated matches [190561] (4 species)
    not a true protein
  7. 2572320Species Human (Homo sapiens) [TaxId:9606] [187549] (78 PDB entries)
  8. 2572503Domain d2mk2a1: 2mk2 A:12-109 [243192]
    Other proteins in same PDB: d2mk2a2
    automated match to d1i3za_

Details for d2mk2a1

PDB Entry: 2mk2 (more details)

PDB Description: Solution NMR structure of N-terminal domain (SH2 domain) of human Inositol polyphosphate phosphatase-like protein 1 (INPPL1) (fragment 20-117), Northeast Structural Genomics Consortium Target HR9134A
PDB Compounds: (A:) Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2

SCOPe Domain Sequences for d2mk2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mk2a1 d.93.1.0 (A:12-109) automated matches {Human (Homo sapiens) [TaxId: 9606]}
swyhrdlsraaaeellaragrdgsflvrdsesvagafalcvlyqkhvhtyrilpdgedfl
avqtsqgvpvrrfqtlgeliglyaqpnqglvcalllpv

SCOPe Domain Coordinates for d2mk2a1:

Click to download the PDB-style file with coordinates for d2mk2a1.
(The format of our PDB-style files is described here.)

Timeline for d2mk2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2mk2a2