| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies) 3 helices; bundle, right-handed twist |
Superfamily a.5.2: UBA-like [46934] (5 families) ![]() |
| Family a.5.2.1: UBA domain [46935] (25 proteins) |
| Protein automated matches [190533] (3 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [255306] (4 PDB entries) |
| Domain d2mj5b1: 2mj5 B:913-959 [243190] Other proteins in same PDB: d2mj5a_, d2mj5b2 automated match to d2cp8a1 |
PDB Entry: 2mj5 (more details)
SCOPe Domain Sequences for d2mj5b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2mj5b1 a.5.2.1 (B:913-959) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sedqtaalmahlfemgfcdrqlnlrllkkhnynilqvvtellqlnnn
Timeline for d2mj5b1: