SCOPe 2.08: Domain d2mi6a1: 2mi6 A:2-62

Lineage for d2mi6a1 (2mi6 A:2-62)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families)
   many known members contain KOW motif

5. Family b.34.5.0: automated matches [227245] (1 protein)
   not a true family

6. Protein automated matches [227015] (11 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [255503] (1 PDB entry)

8. Domain d2mi6a1: 2mi6 A:2-62 [243187]
   Other proteins in same PDB: d2mi6a2
   automated match to d1nz9a_

Details for d2mi6a1

PDB Entry: 2mi6

PDB Description: Solution structure of the carboxy terminal domain of NusG from Mycobacterium tuberculosis

PDB Compounds: (A:) Transcription termination/antitermination protein NusG

SCOPe Domain Sequences for d2mi6a1:

Sequence; same for both SEQRES and ATOM records:

>d2mi6a1 b.34.5.0 (A:2-62) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
rpvvevdyevgesvtvmdgpfatlpatisevnaeqqklkvlvsifgretpveltfgqvsk
i

Timeline for d2mi6a1:

• d2mi6a1 first appeared in SCOPe 2.04, called d2mi6a_
  
• d2mi6a1 appears in SCOPe 2.07