Lineage for d2mi6a1 (2mi6 A:2-62)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2376890Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2377951Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families) (S)
    many known members contain KOW motif
  5. 2378252Family b.34.5.0: automated matches [227245] (1 protein)
    not a true family
  6. 2378253Protein automated matches [227015] (6 species)
    not a true protein
  7. 2378263Species Mycobacterium tuberculosis [TaxId:1773] [255503] (1 PDB entry)
  8. 2378264Domain d2mi6a1: 2mi6 A:2-62 [243187]
    Other proteins in same PDB: d2mi6a2
    automated match to d1nz9a_

Details for d2mi6a1

PDB Entry: 2mi6 (more details)

PDB Description: Solution structure of the carboxy terminal domain of NusG from Mycobacterium tuberculosis
PDB Compounds: (A:) Transcription termination/antitermination protein NusG

SCOPe Domain Sequences for d2mi6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mi6a1 b.34.5.0 (A:2-62) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
rpvvevdyevgesvtvmdgpfatlpatisevnaeqqklkvlvsifgretpveltfgqvsk
i

SCOPe Domain Coordinates for d2mi6a1:

Click to download the PDB-style file with coordinates for d2mi6a1.
(The format of our PDB-style files is described here.)

Timeline for d2mi6a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2mi6a2