SCOPe 2.07: Domain d2mhna1: 2mhn A:4-94

Lineage for d2mhna1 (2mhn A:4-94)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families)

5. Family d.58.7.1: Canonical RBD [54929] (70 proteins)
   Pfam PF00076
   Pfam PF13893

6. Protein automated matches [190332] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187155] (30 PDB entries)

8. Domain d2mhna1: 2mhn A:4-94 [243186]
   Other proteins in same PDB: d2mhna2
   automated match to d2cq4a1

Details for d2mhna1

PDB Entry: 2mhn

PDB Description: NMR structure of the first RRM domain of the protein RBM39 from Homo sapiens

PDB Compounds: (A:) RNA-binding protein 39

SCOPe Domain Sequences for d2mhna1:

Sequence; same for both SEQRES and ATOM records:

>d2mhna1 d.58.7.1 (A:4-94) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nltpeerdartvfcmqlaarirprdleeffstvgkvrdvrmisdrnsrrskgiayvefvd
vssvplaigltgqrvlgvpiivqasqaeknr

Timeline for d2mhna1:

• d2mhna1 first appeared in SCOPe 2.04, called d2mhna_
  
• d2mhna1 appears in SCOPe 2.06
  
• d2mhna1 appears in the current release, SCOPe 2.08