SCOPe 2.08: Domain d2mgwa1: 2mgw A:913-959

Lineage for d2mgwa1 (2mgw A:913-959)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
   3 helices; bundle, right-handed twist

4. Superfamily a.5.2: UBA-like [46934] (5 families)

5. Family a.5.2.1: UBA domain [46935] (25 proteins)

6. Protein automated matches [190533] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255306] (4 PDB entries)

8. Domain d2mgwa1: 2mgw A:913-959 [243185]
   Other proteins in same PDB: d2mgwa2
   automated match to d2cp8a1

Details for d2mgwa1

PDB Entry: 2mgw

PDB Description: solution structure of the uba domain of human nbr1

PDB Compounds: (A:) Next to BRCA1 gene 1 protein

SCOPe Domain Sequences for d2mgwa1:

Sequence; same for both SEQRES and ATOM records:

>d2mgwa1 a.5.2.1 (A:913-959) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sedqtaalmahlfemgfcdrqlnlrllkkhnynilqvvtellqlnnn

Timeline for d2mgwa1:

• d2mgwa1 first appeared in SCOPe 2.04, called d2mgwa_
  
• d2mgwa1 appears in SCOPe 2.07