Lineage for d2mgwa1 (2mgw A:913-959)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2308343Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 2308367Superfamily a.5.2: UBA-like [46934] (5 families) (S)
  5. 2308368Family a.5.2.1: UBA domain [46935] (25 protein domains)
  6. 2308464Protein automated matches [190533] (3 species)
    not a true protein
  7. 2308493Species Human (Homo sapiens) [TaxId:9606] [255306] (4 PDB entries)
  8. 2308496Domain d2mgwa1: 2mgw A:913-959 [243185]
    Other proteins in same PDB: d2mgwa2
    automated match to d2cp8a1

Details for d2mgwa1

PDB Entry: 2mgw (more details)

PDB Description: Solution Structure of the UBA Domain of Human NBR1
PDB Compounds: (A:) Next to BRCA1 gene 1 protein

SCOPe Domain Sequences for d2mgwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mgwa1 a.5.2.1 (A:913-959) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sedqtaalmahlfemgfcdrqlnlrllkkhnynilqvvtellqlnnn

SCOPe Domain Coordinates for d2mgwa1:

Click to download the PDB-style file with coordinates for d2mgwa1.
(The format of our PDB-style files is described here.)

Timeline for d2mgwa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2mgwa2