Lineage for d1qh7b_ (1qh7 B:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1307103Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1307104Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1308405Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)
  6. 1308450Protein Xylanase II [49979] (18 species)
    Partial overlap with common fold and the active sites of the other endoglucanases
  7. 1308462Species Bacillus agaradhaerens [TaxId:76935] [49982] (4 PDB entries)
  8. 1308466Domain d1qh7b_: 1qh7 B: [24318]
    complexed with xyp

Details for d1qh7b_

PDB Entry: 1qh7 (more details), 1.78 Å

PDB Description: catalysis and specificity in enzymatic glycoside hydrolases: a 2,5b conformation for the glycosyl-enzyme intermidiate revealed by the structure of the bacillus agaradhaerens family 11 xylanase
PDB Compounds: (B:) xylanase

SCOPe Domain Sequences for d1qh7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qh7b_ b.29.1.11 (B:) Xylanase II {Bacillus agaradhaerens [TaxId: 76935]}
eivtdnsignhdgydyefwkdsggsgtmilnhggtfsaqwnnvnnilfrkgkkfnetqth
qqvgnmsinyganfqpngnaylcvygwtvdplveyyivdswgnwrppgatpkgtitvdgg
tydiyetlrvnqpsikgiatfkqywsvrrskrtsgtisvsnhfrawenlgmnmgkmyeva
ltvegyqssgsanvysntlringnpls

SCOPe Domain Coordinates for d1qh7b_:

Click to download the PDB-style file with coordinates for d1qh7b_.
(The format of our PDB-style files is described here.)

Timeline for d1qh7b_: