Lineage for d2mcza2 (2mcz A:61-122)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3034014Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
    disulfide-rich all-beta fold
  4. 3034015Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families) (S)
  5. 3034310Family g.18.1.0: automated matches [254264] (1 protein)
    not a true family
  6. 3034311Protein automated matches [254611] (1 species)
    not a true protein
  7. 3034312Species Human (Homo sapiens) [TaxId:9606] [255500] (8 PDB entries)
  8. 3034335Domain d2mcza2: 2mcz A:61-122 [243174]
    automated match to d1gkna2

Details for d2mcza2

PDB Entry: 2mcz (more details)

PDB Description: CR1 Sushi domains 1 and 2
PDB Compounds: (A:) complement receptor type 1

SCOPe Domain Sequences for d2mcza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mcza2 g.18.1.0 (A:61-122) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kscrnppdpvngmvhvikgiqfgsqikysctkgyrligsssatciisgdtviwdqetpic
dr

SCOPe Domain Coordinates for d2mcza2:

Click to download the PDB-style file with coordinates for d2mcza2.
(The format of our PDB-style files is described here.)

Timeline for d2mcza2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2mcza1