Class g: Small proteins [56992] (100 folds) |
Fold g.18: Complement control module/SCR domain [57534] (1 superfamily) disulfide-rich all-beta fold |
Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families) |
Family g.18.1.0: automated matches [254264] (1 protein) not a true family |
Protein automated matches [254611] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255500] (8 PDB entries) |
Domain d2mcya1: 2mcy A:61-122 [243171] Other proteins in same PDB: d2mcya2 automated match to d1gkga1 |
PDB Entry: 2mcy (more details)
SCOPe Domain Sequences for d2mcya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2mcya1 g.18.1.0 (A:61-122) automated matches {Human (Homo sapiens) [TaxId: 9606]} kscrnppdpvngmvhvikgiqfgsqikysctkgyrligsssatciisgdtviwdtetpic dr
Timeline for d2mcya1: