| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.13: DsbA-like [100953] (4 proteins) contains an all-alpha subdomain insertion |
| Protein automated matches [190208] (8 species) not a true protein |
| Species Klebsiella pneumoniae [TaxId:507522] [229321] (2 PDB entries) |
| Domain d2mbsa1: 2mbs A:1-188 [243167] Other proteins in same PDB: d2mbsa2 automated match to d4mcue_ |
PDB Entry: 2mbs (more details)
SCOPe Domain Sequences for d2mbsa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2mbsa1 c.47.1.13 (A:1-188) automated matches {Klebsiella pneumoniae [TaxId: 507522]}
aqitdgkqyitldkpiagepqvleffsfycphcyqfeevlhvsdnvrqklpegtkmtkyh
veflgplgkdltqawavaialgvedkitapmfeavqktqtvqsvadirkvfvdagvkged
ydaawnsfvvkslvaqqekaaadlqlqgvpamyvngkyqlnpqgmdtsnmdvfvaqyadt
vkqlvekk
Timeline for d2mbsa1: