Lineage for d2mbsa1 (2mbs A:1-188)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878376Family c.47.1.13: DsbA-like [100953] (4 proteins)
    contains an all-alpha subdomain insertion
  6. 2878773Protein automated matches [190208] (8 species)
    not a true protein
  7. 2878792Species Klebsiella pneumoniae [TaxId:507522] [229321] (2 PDB entries)
  8. 2878799Domain d2mbsa1: 2mbs A:1-188 [243167]
    Other proteins in same PDB: d2mbsa2
    automated match to d4mcue_

Details for d2mbsa1

PDB Entry: 2mbs (more details)

PDB Description: NMR solution structure of oxidized KpDsbA
PDB Compounds: (A:) thiol:disulfide interchange protein

SCOPe Domain Sequences for d2mbsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mbsa1 c.47.1.13 (A:1-188) automated matches {Klebsiella pneumoniae [TaxId: 507522]}
aqitdgkqyitldkpiagepqvleffsfycphcyqfeevlhvsdnvrqklpegtkmtkyh
veflgplgkdltqawavaialgvedkitapmfeavqktqtvqsvadirkvfvdagvkged
ydaawnsfvvkslvaqqekaaadlqlqgvpamyvngkyqlnpqgmdtsnmdvfvaqyadt
vkqlvekk

SCOPe Domain Coordinates for d2mbsa1:

Click to download the PDB-style file with coordinates for d2mbsa1.
(The format of our PDB-style files is described here.)

Timeline for d2mbsa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2mbsa2