Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) contains a small beta-sheet (wing) |
Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
Protein automated matches [190154] (92 species) not a true protein |
Species Nematode (Brugia malayi) [TaxId:6279] [255498] (1 PDB entry) |
Domain d2mbfa_: 2mbf A: [243161] automated match to d3co6c_ |
PDB Entry: 2mbf (more details)
SCOPe Domain Sequences for d2mbfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2mbfa_ a.4.5.0 (A:) automated matches {Nematode (Brugia malayi) [TaxId: 6279]} npwgaesysdliakalkstfdgrmrlneiynwfasnvpyfgnrtsqeqsagwknsirhnl slhsrfmriqnegagksswwvinpdakpgrnprrqrsatle
Timeline for d2mbfa_: