Lineage for d2mbfa_ (2mbf A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694554Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2694555Protein automated matches [190154] (92 species)
    not a true protein
  7. 2694974Species Nematode (Brugia malayi) [TaxId:6279] [255498] (1 PDB entry)
  8. 2694975Domain d2mbfa_: 2mbf A: [243161]
    automated match to d3co6c_

Details for d2mbfa_

PDB Entry: 2mbf (more details)

PDB Description: Solution structure of the forkhead domain of Brugia malayi DAF-16a
PDB Compounds: (A:) Fork head domain containing protein

SCOPe Domain Sequences for d2mbfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mbfa_ a.4.5.0 (A:) automated matches {Nematode (Brugia malayi) [TaxId: 6279]}
npwgaesysdliakalkstfdgrmrlneiynwfasnvpyfgnrtsqeqsagwknsirhnl
slhsrfmriqnegagksswwvinpdakpgrnprrqrsatle

SCOPe Domain Coordinates for d2mbfa_:

Click to download the PDB-style file with coordinates for d2mbfa_.
(The format of our PDB-style files is described here.)

Timeline for d2mbfa_: