Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423 |
Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) share with the family I the common active site structure with a circularly permuted topology |
Family c.45.1.1: Dual specificity phosphatase-like [52800] (9 proteins) |
Protein Protein tyrosine phosphatase type IVa [102418] (3 species) |
Species Human (Homo sapiens), pr-3 [TaxId:9606] [102419] (4 PDB entries) Uniprot O75365 1-162 # 99% sequence identity |
Domain d2mbca_: 2mbc A: [243160] automated match to d1v3aa_ |
PDB Entry: 2mbc (more details)
SCOPe Domain Sequences for d2mbca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2mbca_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-3 [TaxId: 9606]} marmnrpapvevsykhmrflithnptnatlstfiedlkkygattvvrvcevtydktplek dgitvvdwpfddgapppgkvvedwlslvkakfceapgscvavhcvaglgrapvlvalali esgmkyedaiqfirqkrrgainskqltylekyrpkqrlrfkd
Timeline for d2mbca_: