Class b: All beta proteins [48724] (165 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) |
Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (2 proteins) |
Protein Xylanase II [49979] (16 species) Partial overlap with common fold and the active sites of the other endoglucanases |
Species Bacillus subtilis [TaxId:1423] [49981] (3 PDB entries) |
Domain d1axkb2: 1axk B:157-341 [24316] Other proteins in same PDB: d1axka1, d1axkb1 inserted into a beta-glucanase domain from Bacillus macerans complexed with ca |
PDB Entry: 1axk (more details), 2.1 Å
SCOP Domain Sequences for d1axkb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1axkb2 b.29.1.11 (B:157-341) Xylanase II {Bacillus subtilis [TaxId: 1423]} astdywqnwtdgggivnavngsggnysvnwsntgnfvvgkgwttgspfrtinynagvwap ngngyltlygwtrsplieyyvvdswgtyrptgtykgtvksdggtydiytttrynapsidg drttftqywsvrqskrptgsnatitfsnhvnawkshgmnlgsnwayqvmategyqssgss nvtvw
Timeline for d1axkb2: